PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_26005A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 228aa    MW: 25607.9 Da    PI: 10.0214
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_26005AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.28.8e-091463148
                               TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                               rg+W++eEd +l  + +++G             g++R++k+c++rw++yl
  Oropetium_20150105_26005A 14 RGPWSAEEDARLRSYMERHGXXxxXXXXXXXXXGLRRCGKSCRLRWLNYL 63
                               89******************99553333344445**************97 PP

2Myb_DNA-binding39.61.2e-1269112146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                rg +T+eEd  +  + +  G++ W+ Ia++++ gRt++ +k++w++
  Oropetium_20150105_26005A  69 RGGFTPEEDRVICALYAAVGSR-WSVIAAHLP-GRTDNGVKNYWNT 112
                                788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500909.129963IPR017877Myb-like domain
SuperFamilySSF466891.56E-2211110IPR009057Homeodomain-like
SMARTSM007170.0011365IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-171570IPR009057Homeodomain-like
PROSITE profilePS5129421.94364118IPR017930Myb domain
SMARTSM007176.3E-1168116IPR001005SANT/Myb domain
PfamPF002495.6E-1169112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2471118IPR009057Homeodomain-like
CDDcd001675.65E-872114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MGRSPCCDKA GVKRGPWSAE EDARLRSYME RHGXXXXXXX XXXXXXGLRR CGKSCRLRWL  60
NYLRPDLRRG GFTPEEDRVI CALYAAVGSR WSVIAAHLPG RTDNGVKNYW NTRLKKKLFP  120
QSQFPAAAMG IQTPGRRRRP RYHHHNAANN VIADAAAAPL PLRPPWSWSS QPYYTIGVGV  180
GDCHAHMHDR VICSSSLSLS LICLEVERTT RGSDEEAEPT ELGARER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964229.13e-60PREDICTED: transcription factor RAX1-like
SwissprotQ9M2Y95e-55RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A059PRQ14e-58A0A059PRQ1_SALMI; MYB-related transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.16e-58myb domain protein 87